- Recombinant Enterobacteria phage T4 Uncharacterized 4.4 kDa protein in ndd-denB intergenic region (y16L)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1235003
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,354 Da
- E Coli or Yeast
- 13150
- Uncharacterized 4.4 kDa protein in ndd-denB intergenic region (y16L)
Sequence
MMNLLSGWFYILMFYIGVNFPYWMGWSTTAFGFYTP